PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03323.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 505aa    MW: 56607.5 Da    PI: 6.8345
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03323.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-173784148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed +l ++v ++G g+W+++ r  g++R++k+c++rw ++l
  mrna03323.1-v1.0-hybrid 37 KGPWTAVEDRILMEYVSKHGEGNWNAVQRNSGLKRCGKSCRLRWANHL 84
                             79******************************************9986 PP

2Myb_DNA-binding51.32.7e-1690133146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g +T+eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
  mrna03323.1-v1.0-hybrid  90 KGQFTPEEERLILELHAKYGNK-WARMASQLP-GRTDNEIKNYWNT 133
                              799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9393284IPR017930Myb domain
SuperFamilySSF466893.95E-3133131IPR009057Homeodomain-like
SMARTSM007171.6E-143686IPR001005SANT/Myb domain
PfamPF002497.9E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-233891IPR009057Homeodomain-like
CDDcd001675.28E-113984No hitNo description
PROSITE profilePS5129425.99485139IPR017930Myb domain
SMARTSM007171.4E-1689137IPR001005SANT/Myb domain
PfamPF002491.5E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2692139IPR009057Homeodomain-like
CDDcd001678.18E-1393133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MAYNGNNDIN GNALYSEGSP SELSCGLMEG NNMGLKKGPW TAVEDRILME YVSKHGEGNW  60
NAVQRNSGLK RCGKSCRLRW ANHLRPNLKK GQFTPEEERL ILELHAKYGN KWARMASQLP  120
GRTDNEIKNY WNTRVKKRLR KGLPLYPQDI NPSKRTDTNF SFQSHPSSSQ NQTQLPPRPS  180
QNQHNSTFNH SLPLYDPTTS MPSFNFHHPA QMLGTPLGYK RYQEDIGFSP PISPTRQRNS  240
SILRTTSMPD IASYQQFATG TNSMSDIFSF QFQLQTQTPQ LPSSQASHTR SLSDITTTSH  300
ANFINATHSS DGFLEQLLQE AERFGYGSHP IRKQIGGQLD SSDHEKSYAF DGYGHSLAST  360
AMDSSLLEMK PTQDHEQMNS IPKYLAKLFS FNSSTELVPN SNDGESTELP NSSSLEMKPT  420
HQDHDDEHIN SIPKYLAKLF SFNLSTDQAV PNSYNGESTK LPNSQTSGVT EGSHLEFDMQ  480
QRMDSFFPAA NSWDNLAETS VEVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-30351395108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133139RVKKRLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011461045.10.0PREDICTED: transcription factor MYB29-like
TrEMBLM5X5101e-98M5X510_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-69myb domain protein 101